.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o2a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a protein of unknown function from Streptococcus agalactiae. To be Published 2006
    Site MCSG
    PDB Id 2o2a Target Id APC85695
    Molecular Characteristics
    Source Streptococcus agalactiae 2603v
    Alias Ids TPS5783,AAN00214.1, PF06619, 208435 Molecular Weight 14471.51 Da.
    Residues 126 Isoelectric Point 4.41
    Sequence mevireqefvnqyhydarnleweeengtpktnfevtfqlanrdeaakvtsivavlqfvivrdefvisgv isqmahiqgrlinepsefsqdevenlaaplleivkrltyevteialdrpgvtlefns
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.10 Rfree 0.25232
    Matthews' coefficent 2.42 Rfactor 0.20148
    Waters 242 Solvent Content 49.13

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2o2a

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch