.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nqw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the transporter associated domain from PG_0272, a CBS domain protein from Porphyromonas gingivalis. TO BE PUBLISHED
    Site MCSG
    PDB Id 2nqw Target Id APC85796.2
    Molecular Characteristics
    Source Porphyromonas gingivalis w83
    Alias Ids TPS5789,AAQ65492.1, PF03471, 242619 Molecular Weight 10394.20 Da.
    Residues 90 Isoelectric Point 4.51
    Sequence eeelpfkvlgdgsylfegktslsdvrhyldlpenafgelgdevdtlsglfleikqelphvgdtavyepf rfqvtqmdkrriieikifpfe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.30 Rfree 0.16715
    Matthews' coefficent 2.03 Rfactor 0.12978
    Waters 185 Solvent Content 39.48

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 2nqw

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch