The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a conserved hypothetical protein SP1372 from Streptococcus pneumoniae. To be Published
    Site MCSG
    PDB Id 2iaz Target Id APC80495
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5606,AAK75470, BIG_161.2, 170187 Molecular Weight 12456.48 Da.
    Residues 112 Isoelectric Point 4.81
    Sequence msniydsanelsrglrglpeykavkaakdaiaadaeaskiftdylafqeeiqklaqtgqmpdasfqakm egfgkqiqgnsllsefftkqqqlaiylsdiekivfepvsellk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.28902
    Matthews' coefficent 2.60 Rfactor 0.22872
    Waters 105 Solvent Content 52.74

    Ligand Information


    Google Scholar output for 2iaz

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch