.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i79

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the acetyltransferase of GNAT family from Streptococcus pneumoniae. To be Published
    Site MCSG
    PDB Id 2i79 Target Id APC80653
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5616,AAK76011, 170187 Molecular Weight 19338.12 Da.
    Residues 172 Isoelectric Point 5.13
    Sequence meyellireaepkdaaelvaflnrvsletdftsldgdgilltseemeiflnkqassdnqitllaflngk iagivnitadqrkrvrhigdlfivigkrywnnglgsllleeaiewaqasgilrrlqltvqtrnqaavhl yqkhgfviegsqergayieegkfidvylmgklig
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.10 Rfree 0.25133
    Matthews' coefficent 2.83 Rfactor 0.20823
    Waters 339 Solvent Content 56.58

    Ligand Information
    Ligands ACO (ACETYL) x 6
    Metals

    Jmol

     
    Google Scholar output for 2i79
    1. SHOP: A Method For Structure_Based Fragment and Scaffold Hopping
    F Fontaine, S Cross, G Plasencia, M Pastor - , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch