.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i5e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a hypothetical protein MM_2497 from Methanosarcina mazei Go1. To be Published
    Site MCSG
    PDB Id 2i5e Target Id APC86122
    Molecular Characteristics
    Source Methanosarcina mazei go1
    Alias Ids TPS5827,AAM32193.1, PF01983, 192952 Molecular Weight 23049.24 Da.
    Residues 208 Isoelectric Point 4.98
    Sequence mravipykkagaksrlspvlslqereefvelmlnqvisslkgagieqvdilspsvygleemtearvlld ekdlnealnrylkeaeepvlivmadlpllspehikeisstekdvcivpgkgggtnalfiknpskyrvky ygssflthcsiatdsgqdfeiydsfmagtdidepedlvellihgkgaakdyieskfrlevkkgrvglvpl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.24866
    Matthews' coefficent 2.46 Rfactor 0.19159
    Waters 173 Solvent Content 49.96

    Ligand Information
    Ligands TRS (2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL) x 5;PEG (DI(HYDROXYETHYL)ETHER) x 3
    Metals

    Jmol

     
    Google Scholar output for 2i5e

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch