.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hiy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of conserved bacterial protein SP0830 from Streptococcus pneumoniae. (CASP Target). To be Published
    Site MCSG
    PDB Id 2hiy Target Id APC80351
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5599,AAK74961, 170187 Molecular Weight 20931.06 Da.
    Residues 180 Isoelectric Point 6.33
    Sequence mtryallvrginvggknkvvmaelrqeltnlglekvesyinsgnifftsidskaqlvekletffavhyp fiqsfsllsledfeaelenlpawwsrdlarkdflfytegldvdqviatveslelkdevlyfgklgifwg kfseesysktayhkyllkvpfyrhitirnaktfdkigqmlkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.40 Rfree 0.19439
    Matthews' coefficent 2.62 Rfactor 0.16269
    Waters 1657 Solvent Content 53.01

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals CL (CHLORIDE) x 4;MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 2hiy
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch