.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hi1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a putative 4-hydroxythreonine-4-phosphate dehydrogenase from Salmonella typhimurium. To be Published
    Site MCSG
    PDB Id 2hi1 Target Id APC22899
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS5246,NP_459168, 99287 Molecular Weight 35062.58 Da.
    Residues 327 Isoelectric Point 6.26
    Sequence metktvaitmgdpagigpeiivkalsedglngaplvvigclatlkrlqakgitpnvelraiervaearf apgiihvideplaqpealeagkvqaqagdlayrcvkratelalrgdvqaiataplnkealhlaghnypg htellatlthsrdyamvlytdklkvihvsthialrkfldtlstarvetvigiadtflkrvgyvkpriav agvnphagenglfgdeetriltpaitdarakgmdvygpcppdtvflqayegqydmvvamyhdqghiplk llgfydgvnitaglpfirtsadhgtafdiawtgkaksesmavsiklamqla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.26613
    Matthews' coefficent 2.55 Rfactor 0.187
    Waters 422 Solvent Content 51.85

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hi1
    1. Coenzyme biosynthesis: enzyme mechanism, structure and inhibition
    DE Scott, A Ciulli, C Abell - Natural product reports, 2007 - pubs.rsc.org
     
    2. Investigating terephthalate biodegradation: Structural characterization of a putative decarboxylating cis-dihydrodiol dehydrogenase
    J Bains, JE Wulff, MJ Boulanger - Journal of Molecular Biology, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch