The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of the Putative NAD(P)H-Flavin Oxidoreductase from Streptococcus pyogenes M1 GAS. To be Published 2006
    Site MCSG
    PDB Id 2hay Target Id APC29758
    Molecular Characteristics
    Source Streptococcus pyogenes m1 gas
    Alias Ids TPS5476,AAK33511, 160490 Molecular Weight 25281.80 Da.
    Residues 221 Isoelectric Point 6.51
    Sequence mdqtihhqiqqalhfrtavrvykeekisdedlalildaawlspssiglegwrfvvldnkpikeeikpfa wgaqyqletashfilliaekharydspaiknsllrrgikegdglnsrlklyesfqkedmdmadnpralf dwtakqtyialgnmmmtaallgidtcpiegfhydkvnhilakhnvidlekegiasmlslgyrlrdpkha qvrkpkeevisvvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.11 Rfree 0.23246
    Matthews' coefficent 2.34 Rfactor 0.17456
    Waters 609 Solvent Content 47.36

    Ligand Information
    Ligands SO4 (SULFATE) x 5;FMN (FLAVIN) x 4


    Google Scholar output for 2hay

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch