.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gre

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Deblocking aminopeptidase from Bacillus cereus. To be Published
    Site MCSG
    PDB Id 2gre Target Id APC25341
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5329,AAP07888, 226900 Molecular Weight 38857.61 Da.
    Residues 349 Isoelectric Point 5.35
    Sequence mahhtketmelikelvsipspsgntakiinfienyvsewnvetkrnnkgaliltvkgkndaqhrlltah vdtlgamvkeikpdgrlslsmiggfrwnsvegeyceietssgktytgtilmhqtsvhvykdageakrde knievridervfsadevrelgievgdfvsfdprvqitesgyiksrhlddkvsvaillklikrlqdenvt lpytthflisnneeigyggnsnipeetveylavdmgalgdgqasdeytvsicakdssgpyhyalrkhlv elaktnhieykvdiypyygsdasaairagfdvkhaligagidsshaferthessiahtealvyayvmsnliee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 16
    Resolution (Å) 2.65 Rfree 0.26394
    Matthews' coefficent 2.62 Rfactor 0.19439
    Waters 982 Solvent Content 53.09

    Ligand Information
    Ligands SO4 (SULFATE) x 16
    Metals

    Jmol

     
    Google Scholar output for 2gre
    1. Identification and characterization of endoglucanases for fungicidal activity in Anabaena laxa (Cyanobacteria)
    V Gupta, C Natarajan, K Kumar, R Prasanna - Journal of Applied , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch