The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of the DNA/Pantothenate Metabolism Flavoprotein from Streptococcus pneumoniae. To be Published
    Site MCSG
    PDB Id 2gk4 Target Id APC80454
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5603,AAK75336, 170187 Molecular Weight 25763.29 Da.
    Residues 229 Isoelectric Point 5.99
    Sequence mkilvtsggtseaidsvrsitnhstghlgkiitetllsagyevclittkralkpephpnlsireitntk dlliemqervqdyqvlihsmavsdytpvymtgleevqassnlkeflskqnhqakisstdevqvlflkkt pkiislvkewnptihligfkllvdvtedhlvdiarksliknqadliiandltqisadqhraifveknql qtvqtkeeiaelllekiqayhs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.83 Rfree 0.22945
    Matthews' coefficent 2.23 Rfactor 0.17825
    Waters 404 Solvent Content 44.83

    Ligand Information
    Ligands GOL (GLYCEROL) x 3


    Google Scholar output for 2gk4

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch