.
The Open Protein Structure Annotation Network
PDB Keyword
.

2g2c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of putative molybdenum cofactor biosynthesis protein from Corynebacterium diphtheriae. To be Published
    Site MCSG
    PDB Id 2g2c Target Id APC82505
    Molecular Characteristics
    Source Corynebacterium diphtheriae
    Alias Ids TPS5679,CAE49016.1, 1717 Molecular Weight 17429.76 Da.
    Residues 164 Isoelectric Point 5.42
    Sequence mhiksaiivvsdristgtrenkalpllqrlmsdelqdysyelisevvvpegydtvveaiatalkqgarf iitaggtgiraknqtpeatasfihtrcegleqqilihgsththlaglsrgivgvtgrddhaalivnaps ssggitdtwavispvipnifegldas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.2021
    Matthews' coefficent 2.13 Rfactor 0.1707
    Waters 211 Solvent Content 42.22

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 2g2c

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch