.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fsw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Transcriptional Regualator, MarR family from Porphyromonas gingivalis W83. To be Published
    Site MCSG
    PDB Id 2fsw Target Id APC80877
    Molecular Characteristics
    Source Porphyromonas gingivalis w83
    Alias Ids TPS5630,AAQ65978.1, 242619 Molecular Weight 12090.86 Da.
    Residues 104 Isoelectric Point 9.33
    Sequence merkisdeecpvrksmqifagkwtlliifqinrriirygelkraipgisekmlidelkflcgkglikkk qypevpprveysltplgekvlpiideiakfgmenl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.16 Rfree 0.25004
    Matthews' coefficent 3.43 Rfactor 0.20317
    Waters 165 Solvent Content 64.12

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fsw

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch