.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fre

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the oxidoreductase containing FMN from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 2fre Target Id APC5856
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4875,NP_530728, 176299 Molecular Weight 22345.02 Da.
    Residues 200 Isoelectric Point 5.77
    Sequence mtnsnnrqseypvdplfldrwsprafdgspmpkehlltildaahwapsasnhqpwrfvyahkdsedwpl fvellmegnqkwaknasvllfvisrdhtishegekkpsathsfdagaawfslamqahllgyhahgmggi fkdrivekldipdgfkveagvaigtltdksilpddlaerevpskrvpladvafegrftgkad
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.2124
    Matthews' coefficent 2.50 Rfactor 0.18259
    Waters 405 Solvent Content 50.80

    Ligand Information
    Ligands FMN (FLAVIN) x 2
    Metals

    Jmol

     
    Google Scholar output for 2fre

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch