.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fq4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the transcriptional regulator (TetR family) from Bacillus cereus. To be Published
    Site MCSG
    PDB Id 2fq4 Target Id APC24909
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5310,AAP10105, 226900 Molecular Weight 21650.80 Da.
    Residues 192 Isoelectric Point 9.02
    Sequence mqskrgrprnietqkailsasyelllesgfkavtvdkiaerakvskatiykwwpnkaavvmdgflsaaa arlpvpdtgsalndilihatslanflisregtiinelvgegqfdsklaeeyrvryfqprrlqakqllek gikrgelkenldielsidliygpifyrllvtgeklddsyvhdlvinafegirlr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.79 Rfree 0.26208
    Matthews' coefficent 2.28 Rfactor 0.2355
    Waters 102 Solvent Content 46.15

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fq4
    1. Crystal Structure of Bacillus cereus HlyIIR, a Transcriptional Regulator of the Gene for Pore-forming Toxin Hemolysin II
    OV Kovalevskiy, AA Lebedev, AK Surin - Journal of molecular , 2007 - Elsevier
     
    2. Crystal structure of TM1030 from Thermotoga maritima at 2.3 resolution reveals molecular details of its transcription repressor function
    L Premkumar, CL Rife, S Sri Krishna - Proteins: Structure, , 2007 - Wiley Online Library
     
    3. EM-Fold: De Novo Atomic-Detail Protein Structure Determination from Medium-Resolution Density Maps
    S Lindert, N Alexander, N Wtzel, M Karaka_ - Structure, 2012 - Elsevier
     
    4. CRYO-EM GUIDED DE NOVO PROTEIN FOLDING
    S Lindert - 2011 - etd.library.vanderbilt.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch