.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fck

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an acetyltransferase protein from Vibrio cholerae strain N16961. Proteins 69 422-427 2007
    Site MCSG
    PDB Id 2fck Target Id APC26662
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar eltor str. n16961
    Alias Ids TPS5362,AAF95037, 243277 Molecular Weight 20508.42 Da.
    Residues 178 Isoelectric Point 5.23
    Sequence mtpdfqivtqrlqlrlitadeaeelvqcirqsqtlhqwvdwchalfsqqeaeqfiqatrlnwvkaeayg fgvferqtqtlvgmvainefyhtfnmaslgywigdryqrqgygkealtalilfcferleltrleivcdp envpsqalalrcganreqlapnrflyagepkagivfslip
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.24394
    Matthews' coefficent 2.50 Rfactor 0.21075
    Waters 238 Solvent Content 50.86

    Ligand Information
    Ligands NO3 (NITRATE) x 12;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 2fck
    1. DNA nucleases
    NC HORTON - Structural Biology. Cambridge, UK: The Royal , 2008 - books.google.com
     
    2. Crystal structure of an acetyltransferase protein from Vibrio cholerae strain N16961
    ME Cuff, H Li, S Moy, J Watson - Proteins: Structure, , 2007 - Wiley Online Library
     
    3. Protein frustratometer: a tool to localize energetic frustration in protein molecules
    M Jenik, RG Parra, LG Radusky - Nucleic Acids , 2012 - Oxford Univ Press
     
    4. Integrated Servers for Structure-Informed Function Prediction
    RA Laskowski - From Protein Structure to Function with Bioinformatics, 2009 - Springer
     
    5. MD-SAXS Method with Nonspherical Boundaries
    T Oroguchi, M Ikeguchi - Chemical Physics Letters, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch