.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fb6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of conserved hypothetical protein BT1422 from Bacteroides thetaiotaomicron. To be Published
    Site MCSG
    PDB Id 2fb6 Target Id APC81528
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi
    Alias Ids TPS5663,AAO76529.1, 226186 Molecular Weight 12813.22 Da.
    Residues 114 Isoelectric Point 5.24
    Sequence msandkltilwttdnkdtvfnmlamyalnsknrgwwkhiniilwgasvklvandtqvqteilemlqsgi tieacqdccenfgvasiitnlgitvrymgiplteylkngekilsi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.46 Rfree 0.1613
    Matthews' coefficent 2.14 Rfactor 0.1318
    Waters 133 Solvent Content 42.54

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fb6
    1. Disulfide conformation and design at helix N_termini
    S Indu, ST Kumar, S Thakurela, M Gupta - Proteins: Structure, , 2010 - Wiley Online Library
     
    2. Towards structure-based protein drug design
    C Zhang, L Lai - Biochemical Society Transactions, 2011 - www-06.all-portland.net
     

    Protein Summary

    Structure of BT1422 protein from Bacteroides thetaiotaomicron belongs to DsrEFH-like fold, found in a family of small proteins involved in intracellular sulfur reduction, as well as in a family of bacterial and archeal proteins with unknown function (DUF1291). Several representatives of the latter family, including BT1422 protein, have been solved by structural genomics centers, but function of protein from this family remains unknown.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch