.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fb0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of conserved hypothetical protein from Bacteroides thetaiotaomicron VPI-5482 at 2.10 resolution. To be Published
    Site MCSG
    PDB Id 2fb0 Target Id APC81531
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi
    Alias Ids TPS5664,AAO76535.1, 226186 Molecular Weight 10535.50 Da.
    Residues 91 Isoelectric Point 5.02
    Sequence mirlnvfvrvnetnrekaieaakeltacslkeegciaydtfesstrrdvfmicetwqnaevlaahekta hfaqyvgiiqelaemklekfef
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.2244
    Matthews' coefficent Rfactor 0.19723
    Waters 86 Solvent Content

    Ligand Information
    Ligands ACT (ACETATE) x 1;GOL (GLYCEROL) x 4
    Metals

    Jmol

     
    Google Scholar output for 2fb0
    1. Structural insight of the role of the Hahella chejuensis HapK protein in prodigiosin biosynthesis
    HJ Cho, KJ Kim, MH Kim - : Structure, Function, and , 2008 - Wiley Online Library
     

    Protein Summary

    This Bacteroides thetaiotaomicron protein has a ferrodoxin-like fold, and is a member of large and very diverse super-family of dimeric alpha+beta barrel proteins, that include several families of bacterial proteins, mostly with unknown functions.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch