.
The Open Protein Structure Annotation Network
PDB Keyword
.

2f9h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of PTS System IIA Component from Enterococcus faecalis V583. To be Published 2006
    Site MCSG
    PDB Id 2f9h Target Id APC29475
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5453,AAO82312, 226185 Molecular Weight 13757.77 Da.
    Residues 126 Isoelectric Point 4.84
    Sequence mgwkmqatvteigkhaiddsekmiilfgetatdtlkqhaviqsfpekdqvtlaegdhlkigdtnytitk vgsfansnlqsiahstlifadaptdeddvirngvyltphqlpkitigttidylvnga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.57 Rfree 0.229
    Matthews' coefficent 2.42 Rfactor 0.169
    Waters 257 Solvent Content 49.25

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2f9h

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch