.
The Open Protein Structure Annotation Network
PDB Keyword
.

2f7y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Molybdenum cofactor biosynthesis protein Mog from Shewanella oneidensis. To be Published
    Site MCSG
    PDB Id 2f7y Target Id APC84718
    Related PDB Ids 3k6a 2f7w 
    Molecular Characteristics
    Source Shewanella oneidensis mr-1
    Alias Ids TPS5741,NP_715707, 211586 Molecular Weight 19327.23 Da.
    Residues 177 Isoelectric Point 4.66
    Sequence mskakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlikmadeqdccl ivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqtaglrgdslivnlpgkpks irecldavfpaipycidlmegpylecneavikpfrpkak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.30 Rfree 0.2224
    Matthews' coefficent 3.19 Rfactor 0.19282
    Waters 122 Solvent Content 61.48

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2f7y

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch