.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ew2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Putative 2-Dehydropantoate 2-Reductase from Enterococcus faecalis. To be Published
    Site MCSG
    PDB Id 2ew2 Target Id APC29419
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5451,AAO82163, 226185 Molecular Weight 34436.84 Da.
    Residues 313 Isoelectric Point 5.08
    Sequence mkiaiagagamgsrlgimlhqggndvtlidqwpahieairkngliadfngeevvanlpifspeeidhqn eqvdliialtkaqqldamfkaiqpmitektyvlcllnglghedvlekyvpkenilvgitmwtaglegpg rvkllgdgeielenidpsgkkfalevvdvfqkaglnpsyssnvrysiwrkacvngtlnglctildcnia efgalpvseslvktlisefaavaekeaiyldqaevythivqtydpngiglhypsmyqdliknhrlteid yingavwrkgqkynvatpfcamltqlvhgkeellgak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.21442
    Matthews' coefficent 2.96 Rfactor 0.18116
    Waters 450 Solvent Content 58.49

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 2ew2
    1. Detecting subtle functional differences in ketopantoate reductase and related enzymes using a rule-based approach with sequence-structure homology recognition
    S Mondal, C Nagao, K Mizuguchi - Protein Engineering Design , 2010 - Oxford Univ Press
     
    2. Structural Insights into the Enzyme Mechanism of a New Family of D-2-Hydroxyacid Dehydrogenases, a Close Homolog of 2-Ketopantoate Reductase
    S Mondal, K Mizuguchi - Genome , 2009 - eproceedings.worldscinet.com
     
    3. P03. 10.33
    D Kuroda, H Shirai, M Kobori, H Nakamura - Acta Cryst, 2008 - journals.iucr.org
     
    4. P03. 10.31
    LR Castillo - Acta Cryst, 2008 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch