.
The Open Protein Structure Annotation Network
PDB Keyword
.

2b67

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Nitroreductase Family Protein from Streptococcus pneumoniae TIGR4. To be Published
    Site MCSG
    PDB Id 2b67 Target Id APC80306
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5594,AAK74774, 170187 Molecular Weight 22685.75 Da.
    Residues 201 Isoelectric Point 6.34
    Sequence mkflelnkkrhatkhftdklvdpkdvrtaieiatlapsahnsqpwkfvvvreknaelaklaygsnfeqv ssapvtialftdtdlakrarkiarvggannfseeqlqyfmknlpaefaryseqqvsdylalnaglvamn lvlaltdqgigsniilgfdkskvnevleiedrfrpellitvgytdeklepsyrlpvdeiiekr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.05 Rfree 0.2471
    Matthews' coefficent 2.60 Rfactor 0.17677
    Waters 753 Solvent Content 52.00

    Ligand Information
    Ligands FMN (FLAVIN) x 4;ACY (ACETIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 2b67

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch