The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Acetyltransferase, GNAT family protein SP0256 from Streptococcus pneumoniae. To be Published
    Site MCSG
    PDB Id 2atr Target Id APC80214
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5590,AAK74435, 170187 Molecular Weight 15627.19 Da.
    Residues 138 Isoelectric Point 4.96
    Sequence mitikkqeivkledvlhlyqavgwtnythqtemleqalshslviylaldgdavvglirlvgdgfssvfv qdlivlpsyqrqgigsslmkealgnfkeayqvqlateeteknvgfyrsmgfeilstydctgmiwinrek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.01 Rfree 0.27613
    Matthews' coefficent 2.79 Rfactor 0.21824
    Waters 56 Solvent Content 55.84

    Ligand Information


    Google Scholar output for 2atr

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch