.
The Open Protein Structure Annotation Network
PDB Keyword
.

2apl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein PG0816 from Porphyromonas gingivalis. To be Published
    Site MCSG
    PDB Id 2apl Target Id APC80873
    Molecular Characteristics
    Source Porphyromonas gingivalis w83
    Alias Ids TPS5629,AAQ65973.1, 242619 Molecular Weight 17725.90 Da.
    Residues 157 Isoelectric Point 4.69
    Sequence mkstekkelshfrlkletylnehfpemsgnnpfitarsdealtaycdavaqgfshpeaesmasevlyqg lhfsrydtlvsvlerefeqelpsplperlapillknkaiqsvfakydltddfeaspeyehlyteltgti vlliesnhlptigggndtv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.01 Rfree 0.23367
    Matthews' coefficent 2.60 Rfactor 0.19692
    Waters 80 Solvent Content 51.90

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2apl

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch