.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zvp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a hypothetical protein VC0802 from Vibrio cholerae. To be Published
    Site MCSG
    PDB Id 1zvp Target Id APC26400
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar eltor str. n16961
    Alias Ids TPS5355,AAF93966, 243277 Molecular Weight 14087.27 Da.
    Residues 132 Isoelectric Point 4.67
    Sequence msgikslelllqsmspelmagdyvfctvngalsdylslepiatfrepegltlvleaekaqqaglessal fslitltvhssleavgltaafatklaehgisanviagyyhdhifvqkekaqqalqalgefaqa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.24643
    Matthews' coefficent 3.26 Rfactor 0.21404
    Waters 322 Solvent Content 60.78

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1zvp
    1. Modular arrangement of a cellulosomal scaffoldin subunit revealed from the crystal structure of a cohesin dyad
    I Noach, M Levy-Assaraf, R Lamed, LJW Shimon - Journal of molecular , 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch