.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zpv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of ACT domain protein from Streptococcus pneumoniae. To be Published
    Site MCSG
    PDB Id 1zpv Target Id APC80208
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5588,AAK74418, 170187 Molecular Weight 9670.57 Da.
    Residues 88 Isoelectric Point 4.42
    Sequence mkaiitvvgkdksgivagvsgkiaelglniddisqtvldeyftmmavvssdekqdftylrnefeafgqt lnvkiniqsaaifeamyni
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.90 Rfree 0.24003
    Matthews' coefficent 2.10 Rfactor 0.1891
    Waters 191 Solvent Content 42.30

    Ligand Information
    Ligands
    Metals K (POTASSIUM) x 1

    Jmol

     
    Google Scholar output for 1zpv

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch