.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ylf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of BC1842 protein from Bacillus cereus, a member of the Rrf2 family of putative transcription regulators. To be Published
    Site MCSG
    PDB Id 1ylf Target Id APC22838
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5238,AAP08816, 226900 Molecular Weight 16250.06 Da.
    Residues 146 Isoelectric Point 5.67
    Sequence mitmkissrfsiavhilsilknnpsslctsdymaesvntnpvvirkimsylkqagfvyvnrgpggagll kdlheitlldvyhavnvveedklfhiheqpnpdcpiganiqavleiiliqaqsameevlrnitmgqlfe tlqekmna
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.25
    Matthews' coefficent 2.50 Rfactor 0.217
    Waters 40 Solvent Content 49.40

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 5

    Jmol

     
    Google Scholar output for 1ylf
    1. Detection of protein assemblies in crystals
    E Krissinel, K Henrick - Computational Life Sciences, 2005 - Springer
     
    2. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    3. There's NO stopping NsrR, a global regulator of the bacterial NO stress response
    NP Tucker, NE Le Brun, R Dixon, MI Hutchings - Trends in microbiology, 2010 - Elsevier
     
    4. Insights into the Rrf2 repressor familythe structure of CymR, the global cysteine regulator of Bacillus subtilis
    W Shepard, O Soutourina, E Courtois, P England - FEBS , 2011 - Wiley Online Library
     
    5. Discriminative random field approach to prediction of protein residue contacts
    M Kamada, M Hayashida, J Song - Systems Biology (ISB), , 2011 - ieeexplore.ieee.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch