.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y7u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Acyl-CoA hydrolase from Bacillus cereus. To be Published
    Site MCSG
    PDB Id 1y7u Target Id APC24723
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5306,AAP09007, 226900 Molecular Weight 19312.16 Da.
    Residues 171 Isoelectric Point 8.57
    Sequence mitmtevkgktanesrvfktsrvfptdlndhntlfggkilsemdmvasisasrhsrkecvtasmdwvdf lhpvrssdcvsyesfviwtgrtsmevfvkvvseylisgekriaatsfvtfvalskennpvpvprvipdt eeekeshriavlraeqrhirkaeskkvatlltf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.80 Rfree 0.242
    Matthews' coefficent 4.20 Rfactor 0.197
    Waters 143 Solvent Content 70.70

    Ligand Information
    Ligands SO4 (SULFATE) x 3;COA (COENZYME) x 3
    Metals CA (CALCIUM) x 1

    Jmol

     
    Google Scholar output for 1y7u
    1. Structural basis for recruitment of tandem hotdog domains in acyl-CoA thioesterase 7 and its role in inflammation
    JK Forwood, AS Thakur, G Guncar - Proceedings of the , 2007 - National Acad Sciences
     
    2. Structure of YciA from Haemophilus influenzae (HI0827), a Hexameric Broad Specificity Acyl-Coenzyme A Thioesterase,
    MA Willis, Z Zhuang, F Song, A Howard - Biochemistry, 2008 - ACS Publications
     
    3. Analysis of proteins with the'hot dog'fold: Prediction of function and identification of catalytic residues of hypothetical proteins
    LS Pidugu, K Maity, K Ramaswamy - BMC structural , 2009 - biomedcentral.com
     
    4. Structure and function of a Campylobacter jejuni thioesterase Cj0915, a hexameric hot dog fold enzyme
    T Yokoyama, KJ Choi, AM Bosch, HJ Yeo - Biochimica et Biophysica Acta ( , 2009 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch