.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y1o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal Structure of Penicillin-binding protein-related factor A from Bacillus stearothermophilus. To be Published
    Site MCSG
    PDB Id 1y1o Target Id APC35922
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5526,RBSTP1992, 1422 Molecular Weight 23032.98 Da.
    Residues 200 Isoelectric Point 9.54
    Sequence malkypsgkeyrgnkpnaarrpaadyanrgmtleddlnatneyyrergiavihkkptpvqivrvdypkr saaviteayfrqasttdyngvyrgkyidfeaketknktafplknfhahqirhmeqvvahggicfailrf sllnetylldashliawwnkqeaggrksipkqeierhghsiplgyqpridyisvvdnvyftr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.2482
    Matthews' coefficent 1.90 Rfactor 0.1973
    Waters 144 Solvent Content 33.10

    Ligand Information
    Ligands SO4 (SULFATE) x 11
    Metals NI (NICKEL) x 2

    Jmol

     
    Google Scholar output for 1y1o
    1. The structure of Bacillus subtilis RecU Holliday junction resolvase and its role in substrate selection and sequence-specific cleavage
    N McGregor, S Ayora, S Sedelnikova, B Carrasco - Structure, 2005 - Elsevier
     
    2. The RecU Holliday junction resolvase acts at early stages of homologous recombination
    C Caas, B Carrasco, S Ayora - Nucleic acids research, 2008 - Oxford Univ Press
     
    3. Structure, flexibility, and mechanism of the Bacillus stearothermophilus RecU Holliday junction resolvase
    SJ Kelly, J Li, P Setlow - : Structure, Function, and , 2007 - Wiley Online Library
     
    4. The stalk region of the RecU resolvase is essential for Holliday junction recognition and distortion
    C Ca_as, B Carrasco, E Garca-Tirado - Journal of molecular , 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch