.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y0e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative ManNAc-6-P epimerase from Staphylococcus aureus (strain N315). To be Published
    Site MCSG
    PDB Id 1y0e Target Id APC23088
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus n315
    Alias Ids TPS5256,NP_373553, 158879 Molecular Weight 24503.73 Da.
    Residues 222 Isoelectric Point 4.84
    Sequence mlphglivscqaladeplhssfimskmalaayeggavgirantkedilaiketvdlpvigivkrdydhs dvfitatskevdeliesqcevialdatlqqrpketldelvsyirthapnveimadiatveeaknaarlg fdyigttlhgytsytqgqllyqndfqflkdvlqsvdakviaegnvitpdmykrvmdlgvhcsvvggait rpkeitkrfvqvmed
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.21564
    Matthews' coefficent 3.80 Rfactor 0.17743
    Waters 401 Solvent Content 67.20

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 3
    Metals

    Jmol

     
    Google Scholar output for 1y0e
    1. Quantum Chemical Investigations on Intraresidue Carbonyl_ Carbonyl Contacts in Aspartates of High-Resolution Protein Structures
    TK Pal, R Sankararamakrishnan - The Journal of Physical , 2009 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch