.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xqa

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a possible Glyoxalase from Bacillus cereus. To be Published
    Site MCSG
    PDB Id 1xqa Target Id APC24976
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5319,AAP10513, 226900 Molecular Weight 12615.86 Da.
    Residues 112 Isoelectric Point 5.76
    Sequence mgikhlnltvadvvaareflekyfgltcsgtrgnafavmrdndgfiltlmkgkevqypktfhvgfpqes eeqvdkinqrlkedgflveppkhahaytfyveapggftievmc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.23552
    Matthews' coefficent 2.10 Rfactor 0.18925
    Waters 302 Solvent Content 40.50

    Ligand Information
    Ligands P6G (HEXAETHYLENE) x 1
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 1xqa
    1. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    2. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch