The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of MCSG Target APC26283 from Vibrio cholerae. To be Published
    Site MCSG
    PDB Id 1xpj Target Id APC26283
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar eltor str. n16961
    Alias Ids TPS5347,AAF93408, 243277 Molecular Weight 14646.92 Da.
    Residues 126 Isoelectric Point 5.30
    Sequence mkklivdldgtltqantsdyrnvlprldvieqlreyhqlgfeivistarnmrtyegnvgkinihtlpii tewldkhqvpydeilvgkpwcghdgfyiddravrpsefasmnleeihqlfekekscs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.253
    Matthews' coefficent 2.70 Rfactor 0.201
    Waters 243 Solvent Content 0.53

    Ligand Information
    Ligands TLA (L(+)-TARTARIC) x 4
    Metals HG (MERCURY) x 4


    Google Scholar output for 1xpj

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch