.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xiz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of domain IIA of putative phosphotransferase system specific for mannitol/fructose from Salmonella typhimurium. To be Published
    Site MCSG
    PDB Id 1xiz Target Id APC25506
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS5333,NP_462683, 99287 Molecular Weight 17820.44 Da.
    Residues 157 Isoelectric Point 4.71
    Sequence mqdihfrrhyvrhlpkevsqndiikalasplindgmvvsdfadhvitreqnfptglpvepvgvaiphtd hkyvrqnaisvgilaepvnfedmggepdpvpvrvvfmlalgesnkqlnvlgwimdviqdedfmqqllvm nddeiyqsiytrisergev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.276
    Matthews' coefficent 2.10 Rfactor 0.203
    Waters 164 Solvent Content 39.30

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xiz
    1. Static and dynamic characteristics of protein contact networks
    S Khor - Arxiv preprint arXiv:1011.2222, 2010 - arxiv.org
     
    2. High_resolution structure prediction of a circular permutation loop
    BE Correia, MA Holmes, PS Huang, RK Strong - Protein , 2011 - Wiley Online Library
     
    3. Automatch: Target_binding protein design and enzyme design by automatic pinpointing potential active sites in available protein scaffolds
    C Zhang, L Lai - Proteins: Structure, Function, and , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch