.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vr4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of MCSG TArget APC22750 from Bacillus cereus. To be Published
    Site MCSG
    PDB Id 1vr4 Target Id APC22750
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5234,AAP07999, 226900 Molecular Weight 11034.16 Da.
    Residues 103 Isoelectric Point 4.76
    Sequence mivtttsgiqgkeiieyidivngeaimganivrdlfasvrdvvggragsyesklkeardiamdemkela kqkganaivgvdvdyevvrdgmlmvavsgtavri
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.09 Rfree 0.27655
    Matthews' coefficent 2.20 Rfactor 0.21015
    Waters 151 Solvent Content 43.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vr4
    1. Sequence_similar, structure_dissimilar protein pairs in the PDB
    M Kosloff, R Kolodny - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    2. Structural classification of proteins and structural genomics: new insights into protein folding and evolution
    A Andreeva, AG Murzin - Acta Crystallographica Section F: Structural , 2010 - scripts.iucr.org
     
    3. Crystal Structure of the Outer Membrane Protein RcsF, a New Substrate for the Periplasmic Protein-disulfide Isomerase DsbC
    P Leverrier, JP Declercq, K Denoncin - Journal of Biological , 2011 - ASBMB
     
    4. Crystal structures of rat catechol-O-methyltransferase complexed with coumarine-based inhibitor
    E Tsuji, K Okazaki, K Takeda - Biochemical and biophysical research , 2009 - Elsevier
     
    5. Crystal structure of calcium dodecin (Rv0379), from Mycobacterium tuberculosis with a unique calcium_binding site
    A Arockiasamy, A Aggarwal, CG Savva - Protein , 2011 - Wiley Online Library
     
    6. A disulphide bridge network within the soluble periplasmic domain determines structure and function of the outer membrane protein RcsF
    VV Rogov, NY Rogova, F Bernhard, F Lhr - Journal of Biological , 2011 - ASBMB
     
    7. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    1ybb.png
    No description
    39.75 kB22:12, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch