.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tea

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of tartronate semialdehyde reductase from Salmonella typhimurium. To be Published
    Site MCSG
    PDB Id 1tea Target Id APC25435
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS5331,NP_462161, 99287, Molecular Weight 30726.90 Da.
    Residues 296 Isoelectric Point 5.54
    Sequence mtmkvgfiglgimgkpmsknllkagyslvvsdrnpeaiadviaagaetastakaiaeqcdviitmlpnsp hvkevalgengiiegakpgtvlidmssiaplasreisdalkakgvemldapvsggepkaidgtlsvmvg gdkaifdkyydlmkamagsvvhtgdigagnvtklanqvivalniaamsealtlatkagvnpdlvyqair gglagstvldakapmvmdrnfkpgfridlhikdlanaldtshgvgaqlpltaavmemmqalradghgnd dhsalacyyeklakvevtr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.1438
    Matthews' coefficent 3.60 Rfactor 0.11978
    Waters 497 Solvent Content 66.00

    Ligand Information
    Ligands TAR (D(-)-TARTARIC) x 1
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 1tea

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch