.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t6t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title putative protein from Aquifex aeolicus. To be Published
    Site MCSG
    PDB Id 1t6t Target Id APC22277
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS5219,NP_214428, 224324 Molecular Weight 13717.21 Da.
    Residues 118 Isoelectric Point 9.10
    Sequence mtkeprnlsewikelkkasreavilvegkndkkalskfsiknvidlsgkryadvvdmlegkwekvillf dldthgerinqkmkellssqgflvdenfrnflkkwniihieeinggkns
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.208
    Matthews' coefficent 2.60 Rfactor 0.18
    Waters 395 Solvent Content 52.50

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1t6t
    1. The Sorcerer II Global Ocean Sampling expedition: expanding the universe of protein families
    S Yooseph, G Sutton, DB Rusch, AL Halpern - PLoS biology, 2007 - dx.plos.org
     
    2. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    3. Prediction of protein structure from ideal forms
    WR Taylor, GJ Bartlett, V Chelliah - Proteins: Structure, , 2008 - Wiley Online Library
     
    4. Multiple alignment of protein structures in three dimensions
    E Krissinel, K Henrick - Computational Life Sciences, 2005 - Springer
     
    5. Crystal structure and putative function of small Toprim domain_containing protein from Bacillus stearothermophilus
    P _ez_ov, D Borek, SF Moy - Proteins: Structure, , 2008 - Wiley Online Library
     
    6. Topoisomerases and site-specific recombinases: similarities in structure and mechanism
    W Yang - Critical reviews in biochemistry and molecular , 2010 - ingentaconnect.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch