.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ss4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Glyoxalase Family Protein APC24694 from Bacillus cereus. To be Published
    Site MCSG
    PDB Id 1ss4 Target Id APC24694
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5303,AAP08723, 226900 Molecular Weight 16581.14 Da.
    Residues 150 Isoelectric Point 4.87
    Sequence maknkllrmdnvsivvesldnaisffeeiglnlegranvegewagrvtglgsqcveiammvtpdghsri elsrfltpptiadhrtapvnalgylrvmftvedidemvsrltkhgaelvgevvqyensyrlcyirgveg iliglaeelgnk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.84 Rfree 0.238
    Matthews' coefficent 2.96 Rfactor 0.202
    Waters 276 Solvent Content 58.52

    Ligand Information
    Ligands ACT (ACETATE) x 1;CIT (CITRIC) x 1;FMT (FORMIC) x 4;GTT (GLUTATHIONE) x 1
    Metals NA (SODIUM) x 1;MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 1ss4
    1. Comprehensive secondary_structure analysis of disulfide variants of lysozyme by synchrotron_radiation vacuum_ultraviolet circular dichroism
    K Matsuo, H Watanabe, S Tate - Proteins: Structure, , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch