.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sfs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.07 A crystal structure of an uncharacterized B. stearothermophilus protein. To be Published
    Site MCSG
    PDB Id 1sfs Target Id APC35772
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5509,RBSTP1166, 1422 Molecular Weight 26933.03 Da.
    Residues 240 Isoelectric Point 7.71
    Sequence mhhhhhhssgvdlgtenlyfqsnamargiwgvdsaqvvtdqlfqcvrtelgypkfwgrylsevpnvseg ltrdeivrirnygvkvlpiynafreavgyangqvaarnavfharrlgipknkllfaniedffavdaawi aawvetlyptgyrpglyadptkgdfaaayceavsrnnqvavqaviwsaaprpgttkeqkapryqpaapp csanvwvwqygrdaevcpvdtnladrrlldfly
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.07 Rfree 0.1352
    Matthews' coefficent 1.99 Rfactor 0.1016
    Waters 432 Solvent Content 38.19

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1sfs
    1. Crystal structures of YkuI and its complex with second messenger cyclic Di-GMP suggest catalytic mechanism of phosphodiester bond cleavage by EAL domains
    G Minasov, S Padavattan, L Shuvalova - Journal of Biological , 2009 - ASBMB
     
    2. Dependence of alpha-helical and beta-sheet amino acid propensities on the overall protein fold type
    K Fujiwara, H Toda, M Ikeguchi - BMC Structural Biology, 2012 - biomedcentral.com
     
    3. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     
    4. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch