The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Putative cytoplasmic protein from Salmonella typhimurium. To be Published
    Site MCSG
    PDB Id 1s4k Target Id APC23375
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS5265,NP_460328, 99287 Molecular Weight 14076.34 Da.
    Residues 119 Isoelectric Point 5.43
    Sequence mmnalelqalrrifdmtieectiyitqdnnsatwqrweagdipispeiiarlkemkarrqrrinaivdk innrignntmryfpdlssfqsiytegdfiewkiyqsvaaelfahdlerlc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.219
    Matthews' coefficent 2.64 Rfactor 0.191
    Waters 394 Solvent Content 53.37

    Ligand Information


    Google Scholar output for 1s4k

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch