.
The Open Protein Structure Annotation Network
PDB Keyword
.

1r7l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of phage protein BC1872 from Bacillus cereus, a singleton with new fold. Proteins 64 280-283 2006
    Site MCSG
    PDB Id 1r7l Target Id APC22846
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5240,AAP08846, 226900 Molecular Weight 11543.90 Da.
    Residues 102 Isoelectric Point 7.79
    Sequence mkprdinkliaskifgyeikddniikdgryrlgiplysqniesawqvvekleydvkvtktdlkpkyqvh vfvpggvkmvfaetapmaickgalasvdielqd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.264
    Matthews' coefficent 2.64 Rfactor 0.223
    Waters 102 Solvent Content 53.36

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1r7l
    1. Structure of phage protein BC1872 from Bacillus cereus, a singleton with new fold
    R Zhang, G Joachimiak, S Jiang - Proteins: Structure, , 2006 - Wiley Online Library
     
    2. Search for identical octapeptides in unrelated proteins: Structural plasticity revisited
    KM Saravanan, S Selvaraj - Peptide Science, 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch