.
The Open Protein Structure Annotation Network
PDB Keyword
.

1r0d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural definition of the F-actin-binding THATCH domain from HIP1R. Nat.Struct.Mol.Biol. 13 121-130 2006
    Site MCSG
    PDB Id 1r0d Target Id APC35300
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS5489,XP_290592, 9606 Molecular Weight 119381.88 Da.
    Residues 1068 Isoelectric Point 6.22
    Sequence mnsiknvparvlsrrpghsleaereqfdktqaisiskaintqeapvkekharriilgthhekgaftfws yaiglplpsssilswkfchvlhkvlrdghpnvlhdcqryrsnireigdlwghlhdrygqlvnvytklll tkisfhlkhpqfpaglevtdevlekaagtdvnnifqltvemfdymdcelklsesvfrqlntaiavsqms sgqcrlapliqviqdcshlyhytvkllfklhsclpadtlqghrdrfheqfhslrnffrrasdmlyfkrl iqiprlpegppnflrasalaehikpvvvipeeapedeepenlieistgppagepvvvadlfdqtfgppn gsvkddrdlqieslkrevemlrselekikleaqryiaqlksqvnalegeleeqrkqkqkalvdneqlrh elaqlraaqlegersqglreeaerkasatearynklkekhselvhvhaellrknadtakqltvtqqsqe evarvkeqlafqveqvkreselkleeksdqleklkreleakagelaraqealshteqskselssrldtl saekdalsgavrqreadllaaqslvreteaalsreqqrssqeqgelqgrlaeresqeqglrqrlldeqf avlrgaaaeaagilqdavsklddplhlrctsspdylvsraqealdavstleeghaqyltsladasalva altrfshlaadtiinggatshlaptdpadrlidtcrecgaralelmgqlqdqqalrhmqaslvrtplqg ilqlgqelkpksldvrqeelgavvdkemaatsaaiedavrriedmmnqarhassgvklevnerilnsct dlmkairllvttstslqkeivesgrgaatqqefyaknsrwteglisaskavgwgatqlveaadkvvlht gkyeelivcsheiaastaqlvaaskvkankhsphlsrlqecsrtvneraanvvastksgqeqiedrdtm dfsglsliklkkqemetqvrvlelektleaermrlgelrkqhyvlagasgspgeevairpstaprsvtt kkpplaqkpsvaprqdhqldkkdgiypaqlvny
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 1.90 Rfree 0.269
    Matthews' coefficent 2.76 Rfactor 0.224
    Waters 1149 Solvent Content 58.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1r0d
    1. Mapping and consensus sequence identification for multiple vinculin binding sites within the talin rod
    AR Gingras, WH Ziegler, R Frank, IL Barsukov - Journal of Biological , 2005 - ASBMB
     
    2. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    3. Structural definition of the F-actinbinding THATCH domain from HIP1R
    TJ Brett, V Legendre-Guillemin - Nature structural & , 2006 - nature.com
     
    4. Interaction between intrinsically disordered proteins frequently occurs in a human protein-protein interaction network
    K Shimizu, H Toh - Journal of molecular biology, 2009 - Elsevier
     
    5. Unusual twinning in an acetyl coenzyme A synthetase (ADP-forming) from Pyrococcus furiosus
    L Lehtio, I Fabrichniy, T Hansen - Section D: Biological , 2005 - scripts.iucr.org
     
    6. Identification and development of mPGES-1 inhibitors: where we are at?
    HH Chang, EJ Meuillet - Future, 2011 - Future Science
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch