The Open Protein Structure Annotation Network
PDB Keyword


    Title Crystal structure of a putative iron-regulated protein A precursor (BDI_2603) from Parabacteroides distasonis ATCC 8503 at 2.30 A resolution. To be published
    Site JCSG
    PDB Id 4ecg Target Id 394678
    Molecular Characteristics
    Source Parabacteroides distasonis atcc 8503
    Alias Ids TPS25342,YP_001303944.1, PF04302, 332805 Molecular Weight 41313.47 Da.
    Residues 380 Isoelectric Point 4.32
    Sequence nddpgkdpdvvtydfknlpadsgakptedqmsavvatfvdevalptykdmltkmtayknavdkfiasgs kndladacdawravrvpweqseaflfgvadlaqldpsldswpldkngieeiiatgefskisgavdedae dgpqnlrgfhtaekmlfldgeprdletspfakneleylklvsermlsdtqdlyngwlkglgtsdvpssy aeamkkhdgsaysignvyqaielmlngnngmagisnevgsakitdpvtawngsnkdatdpnnpgvlave swyswnslddyknnivsiknayfggrdldeesasesslhaltkminptldslmvvqidktidainaigy pfrnnlgdtehintateacadlttglgvvkskftn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.1927
    Matthews' coefficent 2.91 Rfactor 0.1617
    Waters 114 Solvent Content 57.77

    Ligand Information


    Google Scholar output for 4ecg

    Protein Summary

    The protein YP_001303944.1 is annotated as putative iron-regulated protein A precursor. YP_001303944.1 belongs to PFAM PF09375 Peptidase_M75.

    The monomer structure is shown below in rainbow ribbon representation.



    Top 10 DALI Structural Homologs
    N PDB Z-score RMSD LALI NRES %ID Description (JCSG structures highlighted in red)
    1 3pf0 27.9 2.7 296 318 14 Imelysin-like Protein
    2 3at7 23.7 2.1 234 251 19 Alginate-binding Flagellin
    3 3n8u 16.2 2.5 201 352 36 Imelysin Peptidase
    4 3oyv 16.1 2.4 200 354 36 Imelysin
    5 3l74 7.7 4.7 192 380 5 Mitochondrial Ubiquinol-cytochrome-c Reductase
    6 3l71 7.7 4.7 193 379 5 Mitochondrial Ubiquinol-cytochrome-c Reductase
    7 3l70 7.7 4.7 193 379 5 Mitochondrial Ubiquinol-cytochrome-c Reductase
    8 3h1j 7.7 4.7 194 380 4 Mitochondrial Ubiquinol-cytochrome-c Reductase Co
    9 2a06 7.7 4.6 193 369 4 Ubiquinol-cytochrome-c Reductase Complex Core Pro
    10 1zrt 7.7 4.7 190 427 3 Cytochrome B

    A superposition of this protein (green) on 3pf0 (magenta) is shown below.


    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
    No description
    239.63 kB18:58, 24 Jan 2012abhinavkActions
    No description
    319.21 kB18:58, 24 Jan 2012abhinavkActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch