.
The Open Protein Structure Annotation Network
PDB Keyword
.

4dsd

    Title Crystal structure of a putative periplasmic protein (BACOVA_05534) from Bacteroides ovatus ATCC 8483 at 1.75 A resolution. To be published
    Site JCSG
    PDB Id 4dsd Target Id
    reference to undefined name 'note' Exception of type 'MindTouch.Deki.Script.Runtime.DekiScriptUndefinedNameException' was thrown. (click for details)
    Molecular Characteristics
    Source
    reference to undefined name 'note' Exception of type 'MindTouch.Deki.Script.Runtime.DekiScriptUndefinedNameException' was thrown. (click for details)
    reference to undefined name 'note' Exception of type 'MindTouch.Deki.Script.Runtime.DekiScriptUndefinedNameException' was thrown. (click for details)
    Alias Ids
    reference to undefined name 'note' Exception of type 'MindTouch.Deki.Script.Runtime.DekiScriptUndefinedNameException' was thrown. (click for details)
    reference to undefined name 'note' Exception of type 'MindTouch.Deki.Script.Runtime.DekiScriptUndefinedNameException' was thrown. (click for details)
    TPS72258,ZP_02068518.1, 328248
    Molecular Weight
    reference to undefined name 'note' Exception of type 'MindTouch.Deki.Script.Runtime.DekiScriptUndefinedNameException' was thrown. (click for details)
    Da.
    Residues
    reference to undefined name 'note' Exception of type 'MindTouch.Deki.Script.Runtime.DekiScriptUndefinedNameException' was thrown. (click for details)
    Isoelectric Point
    reference to undefined name 'note' Exception of type 'MindTouch.Deki.Script.Runtime.DekiScriptUndefinedNameException' was thrown. (click for details)
    Sequence
    reference to undefined name 'note' Exception of type 'MindTouch.Deki.Script.Runtime.DekiScriptUndefinedNameException' was thrown. (click for details)
      BLAST   FFAS

    Structure Determination
    Method XRAY
    reference to undefined name 'note' Exception of type 'MindTouch.Deki.Script.Runtime.DekiScriptUndefinedNameException' was thrown. (click for details)
    Chains 2
    Resolution (Å)
    reference to undefined name 'note' Exception of type 'MindTouch.Deki.Script.Runtime.DekiScriptUndefinedNameException' was thrown. (click for details)
    Rfree
    reference to undefined name 'note' Exception of type 'MindTouch.Deki.Script.Runtime.DekiScriptUndefinedNameException' was thrown. (click for details)
    Matthews' coefficent 3.07 Rfactor 0.1774
    Waters
    reference to undefined name 'note' Exception of type 'MindTouch.Deki.Script.Runtime.DekiScriptUndefinedNameException' was thrown. (click for details)
    Solvent Content 59.91

    reference to undefined name 'note' Exception of type 'MindTouch.Deki.Script.Runtime.DekiScriptUndefinedNameException' was thrown. (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    parameter 'target' could not convert from 'list' to 'str' (click for details)
    Google Scholar output for 4dsd

    reference to undefined name 'note' Exception of type 'MindTouch.Deki.Script.Runtime.DekiScriptUndefinedNameException' was thrown. (click for details)

    reference to undefined name 'note' Exception of type 'MindTouch.Deki.Script.Runtime.DekiScriptUndefinedNameException' was thrown. (click for details)

    Protein Summary

    This is annotated as a hypothetical protein.

    Note from PFAM:

    This matches our family, DUF2874, PF11396. I built a family then merged the seed with that of the DUF. This is interesting because the DUF is in the PepSY clan, and may be representative of the N-terminal region of YpeB proteins. We look forward to the structure coming through.

     

    A manuscript describing the structure of the homolog with PDB id 3due and structure-based Pfam classification has been published: "The structure of BVU2987 from Bacteroides vulgatus reveals a superfamily of bacterial periplasmic proteins with possible inhibitory function", (2010) Acta Crystallogr.,Sect.F 66: 1265-1273."

     

    The monomer structure in rainbow representation is shown below.

    SP13115C_mon.png

    A preliminary observation of the structure suggests that this protein may be a result of a gene duplication event. The two halves of the protein, indeed allign very well, as shown below.

    SP13115C_NC.png

    This  superposition involves 52 residues with a RMSD of 1.924 A between the N-terminal fragment (residues 21-84 in cyan color) and the C-terminal fragment (residues 85-146 in magenta color).

    Furthermore, the sequence alignment of these fragments shows 25% sequence identity.

    N-term  --KDVITKDMNQLPLPARNFINSN-FTKPQVAHIKIDKDMMESTKYEVVLMDGTEIDFDS
    C-term  SAKKGQTVPVSIVPGFAVNYLKAHNFVNEGVTKVERDR-----KGYEIELSTGLSFKFDK
              *.  *  :. :*  * *::::: *.:  *:::: *:     . **: *  * .:.**.
    
    N-term  KGNWEEV
    C-term  KGKFIKT
            **:: :.
    

     

    The structural homologs of this protein are listed below.

    Top 10 DALI Structural Homologs
     
    N PDB Z-score RMSD LALI NRES %ID Description (JCSG structures highlighted in red)
    1 3elg 19.1 1.5 123 126 44 Uncharacterized Periplasmic Protein
    2 3due 18.4 1.5 121 127 36 Putative Periplasmic Protein
    3 3db7 18.1 1.6 121 127 38 Putative Calcium-regulated Periplasmic Protein
    4 3d4e 5.9 2.6 93 162 8 Putative Beta-lactamase Inhibitor Protein
    5 3buu 5.7 3.9 86 220 7 Uncharacterized Lola Superfamily Protein Ne2245
    6 2fkj 5.7 2.9 77 361 13 Outer Surface Protein a
    7 2af5 5.6 4.0 79 292 9 Engineered Outer Surface Protein a (ospa) with Th
    8 3u1w 5.5 5.3 94 248 13 Hypothetical Periplasmic Protein
    9 3bk5 5.3 3.8 87 235 9 Putative Outer Membrane Lipoprotein-sorting Prote

     

    A superposition on 3elg (orange) is shown below.

    SP13115C_3elg.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch