The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative cell adhesion protein (BT0320) from Bacteroides thetaiotaomicron VPI-5482 at 2.37 A resolution. To be published
    Site JCSG
    PDB Id 4dgu Target Id 393063
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi-5482
    Alias Ids TPS20962,NP_809233.1 Molecular Weight 26354.89 Da.
    Residues 246 Isoelectric Point 4.77
    Sequence delqetskeatnfsisiddalsdpltrtsndlfparnsittgevismaasgqdytpfivgkdsrawnei gtatgtvtfyahypaltdeaatrsggnkrylkggqehlfgtaeaapgsqnvslkfkrmtvpviildend rpyegeakvelslknegtqdllngtieinenalsenievkkvsegvttnvlpqkinageeigtitvggv tqkisavedldlkagstlsvrlskkfgggiidgnvplyr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.37 Rfree 0.2241
    Matthews' coefficent 2.78 Rfactor 0.1869
    Waters 195 Solvent Content 55.73

    Ligand Information


    Google Scholar output for 4dgu

    Protein Summary

    Similar to BF1858, swapped dimer, 3gf8 fimbrilin related.


    Figure 1. domain swapped dimer


    Ligand Summary




    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    115.05 kB19:50, 20 Jan 2012qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch