.
The Open Protein Structure Annotation Network
PDB Keyword
.

4df9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative peptidase (BF3526) from Bacteroides fragilis NCTC 9343 at 2.17 A resolution. To be published
    Site JCSG
    PDB Id 4df9 Target Id 393185
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS24839,YP_213128.1, 332456 Molecular Weight 46035.55 Da.
    Residues 408 Isoelectric Point 5.80
    Sequence aqnfsdyftnktlridylftgnadkqsicldelselpvwagrrhhlselplegngqivmrdvasgkviy ttsfsslfqewletdeakevtkgfentyllpypikpaeveitlrnnkrevsanlkhvvkpddilihkkg lthitphkyllksgneeqcidvailaegyttsemetfykdaaiacealfshepfqsmknrfnivavasp sadsgvsapkqgawkhtafgshfdtfysdrylttsrvkaindalagipyehiiilanteqyggggiyna ftlttahhpnfrpvvvhefghsfggladeyfydedvmnglyplniepweqnittrinfaskwedmltkt tpvptpvadkakypigvyegggysakgiyrpafdcrmrtneyptfcpvcqraiqriiefytgk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.17 Rfree 0.1878
    Matthews' coefficent 2.82 Rfactor 0.1561
    Waters 1950 Solvent Content 56.44

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 4df9

    Protein Summary

    Highly similar to another jcsg structure 3p1v (seq id >80).

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch