.
The Open Protein Structure Annotation Network
PDB Keyword
.

418592

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 418592
    Molecular Characteristics
    Source Shewanella sp. pv-4
    Alias Ids TPS33865,SHEW_20DEC04_CONTIG115_REVISED_GENE324, 3.40.630.10 Molecular Weight 36027.09 Da.
    Residues 325 Isoelectric Point 4.65
    Sequence vapptkgglaeaenkmenkmteqqgywigeagkpwgeaekakwraaqqkkrsyeqevlskfsqvsesfe aqqygelnyaegqyplygfksrdwdqekptilvtggvhgyetsgvqgalrfliakaaeysqdfnilvap cvspwgyetinrwnpeaidpnrsfyadspaqesralmqwvasfnlplmahidlhettdtdnsefrpala ardakvqtnwnipdgfylvgdsenpndemqaaiiaavgkvthiapadeqgrligepitqfgvinyatka lglcsgfsdaryntttevypdsplvddenciqaqvmavssaldyirsqg
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch