.
The Open Protein Structure Annotation Network
PDB Keyword
.

418560

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystal Structure
    Target Id 418560
    Molecular Characteristics
    Source Bartonella henselae str. houston-1
    Alias Ids TPS33860,YP_033104.1, 3.40.630.10 Molecular Weight 50689.77 Da.
    Residues 462 Isoelectric Point 5.39
    Sequence mlnkvlthldeniekslerlfsllrfqsistdfaykdecrkaadwlvedlksigfkasrrdtsghpmvv ghhpgpsddclhvlfyghydvqpvdplnlweddpftpslkeregekvicargasddkgqlmtfieacra fkketgqlpvrvtvlfegeeesgssslvpflkankdelkadcalvcdtsmwdadtpsvsvalrgilgee iiitaanrdlhsgyfggaaanpiriltkvlaglhdennrvtlpgfydgveetpphilqswnalnctaen flgpiglslpagekgrsvlelvwarptaeingisggyegegiktviasqasakvsfrlvhkqdpekirq afrdyvcslipadcsvvfkehgaspaiqlpydspfikaakdalsqewnnpalltvmggsipivadfqsi ldmetllvgfaladdrihspnekynlksfhkgqrswarilatlaktgg
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch