The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 405622
    Molecular Characteristics
    Source Burkholderia ambifaria ammd
    Alias Ids TPS31039,YP_774249.1, PF03724, 322554 Molecular Weight 14696.71 Da.
    Residues 138 Isoelectric Point 6.32
    Sequence apapdpynpaavqllddtsweltswlnadgtsrtiphgdngepiklalstesgirrasgfsgcnrymgt yalkngllsfgplagtrmacpnalggqlehayldalahiaktgvqmrepqqlqivteagatltftrrsp
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch