The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 405221
    Molecular Characteristics
    Source Idiomarina loihiensis l2tr
    Alias Ids TPS31030,YP_155203.1, PF03888, 332234 Molecular Weight 33365.92 Da.
    Residues 297 Isoelectric Point 5.47
    Sequence qqtneqaesgadwfnrmaealtelnfeaslvhvhgdqiepyqwlqgndpetgstelliqmngpdfrilr vnnkvahfntsssnyalesdtitaifpaafsqpferlshsyqvmvgggarvlgrnaqhirilsrdnqry syalwidrkhgmplkmimmnqsgdvveqmqltslsvrdtapeitkeisniemppllkdlrvqsatnysv gprwaprgfkllsqqshtlvvdatpvdhylfsdglaeysvyvaeltegmetdlalssshtlfskrynnf lvtvvgqvpltmaqriaaevk
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch