The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 403397
    Molecular Characteristics
    Source Rhodobacter sphaeroides 2.4.1
    Alias Ids TPS31018,YP_352429.1, 3.40.1190.20, 332511 Molecular Weight 33381.24 Da.
    Residues 316 Isoelectric Point 4.80
    Sequence mptydvssigfyvcdilgrpvtripdggradyiqeirmtvagtagataadcailglktlavttvgedem gdfmvakltrfgvdcamvardgsvqtsatilpvrpngerpalhvpgtaatfripegrldaaldarivhv ggtgllksfdgaptvealrrakelgrittfdliqatpetfelvrpclpyidyfvpsieeasemagttdp aevarffkglgvknailtmggegvyvspeagedfrlpahaievvdttgcgdsftagvivglargwdlrd ccrfasavaarvamglgsdgklvsfedtieamntlplran
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch