The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 403082
    Molecular Characteristics
    Source Idiomarina loihiensis l2tr
    Alias Ids TPS30638,YP_156267.1, _0076.003168_, 370910 Molecular Weight 32271.02 Da.
    Residues 285 Isoelectric Point 4.64
    Sequence maieittaekrllqrvsipprpetlltvsreakksepdvnviaesisadmsiaaavlqvvnsaayrrar evdsiqqavmtlgfrrvfpivravalksaltsdydlsefwrynewvagacvmiaeaigrpelrdhayml glfqssgipvmlaefddyadllnaaestpwqqvqakelelfqtshttigallaqqwklpkivveviyyl fedssifnhsseldnltldllgilkisryaidlrtrslageeewqyvqdgvlehfqidefkvdemlqiv heelfdtea
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch